SCOP 1.73: Domain d1rwyb_: 1rwy B:

Lineage for d1rwyb_ (1rwy B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.4: Parvalbumin [47492] (2 proteins)
   6-helices; array of 3 hairpins, closed
   made with two-helical hairpin and two EF-hands

6. Protein Parvalbumin [47495] (7 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [47501] (4 PDB entries)

8. Domain d1rwyb_: 1rwy B: [98003]

Details for d1rwyb_

PDB Entry: 1rwy, 1.05 Å

PDB Description: crystal structure of rat alpha-parvalbumin at 1.05 resolution

PDB Compounds: (B:) parvalbumin alpha

SCOP Domain Sequences for d1rwyb_:

Sequence; same for both SEQRES and ATOM records:

>d1rwyb_ a.39.1.4 (B:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

Timeline for d1rwyb_:

• d1rwyb_ first appeared in SCOP 1.67
  
• d1rwyb_ appears in SCOP 1.71
  
• d1rwyb_ appears in SCOP 1.75
  
• d1rwyb_ appears in the current release, SCOPe 2.08