Lineage for d1rwyb_ (1rwy B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537668Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 537673Protein Parvalbumin [47495] (7 species)
  7. 537699Species Rat (Rattus rattus) [TaxId:10117] [47501] (4 PDB entries)
  8. 537701Domain d1rwyb_: 1rwy B: [98003]

Details for d1rwyb_

PDB Entry: 1rwy (more details), 1.05 Å

PDB Description: crystal structure of rat alpha-parvalbumin at 1.05 resolution

SCOP Domain Sequences for d1rwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwyb_ a.39.1.4 (B:) Parvalbumin {Rat (Rattus rattus)}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

SCOP Domain Coordinates for d1rwyb_:

Click to download the PDB-style file with coordinates for d1rwyb_.
(The format of our PDB-style files is described here.)

Timeline for d1rwyb_: