Class a: All alpha proteins [46456] (202 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.4: Parvalbumin [47492] (2 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
Protein Parvalbumin [47495] (6 species) |
Species Rat (Rattus rattus) [TaxId:10117] [47501] (3 PDB entries) |
Domain d1rwyb_: 1rwy B: [98003] |
PDB Entry: 1rwy (more details), 1.05 Å
SCOP Domain Sequences for d1rwyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwyb_ a.39.1.4 (B:) Parvalbumin {Rat (Rattus rattus)} smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes
Timeline for d1rwyb_: