Lineage for d1rwyb_ (1rwy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710476Family a.39.1.4: Parvalbumin [47492] (3 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 2710482Protein Parvalbumin [47495] (9 species)
  7. 2710507Species Norway rat (Rattus norvegicus) [TaxId:10116] [158476] (6 PDB entries)
  8. 2710509Domain d1rwyb_: 1rwy B: [98003]
    complexed with acy, ca, nh4, pg4, so4

Details for d1rwyb_

PDB Entry: 1rwy (more details), 1.05 Å

PDB Description: crystal structure of rat alpha-parvalbumin at 1.05 resolution
PDB Compounds: (B:) parvalbumin alpha

SCOPe Domain Sequences for d1rwyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwyb_ a.39.1.4 (B:) Parvalbumin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

SCOPe Domain Coordinates for d1rwyb_:

Click to download the PDB-style file with coordinates for d1rwyb_.
(The format of our PDB-style files is described here.)

Timeline for d1rwyb_: