Lineage for d1rwya_ (1rwy A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 768641Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 768647Protein Parvalbumin [47495] (8 species)
  7. 768673Species Rat (Rattus rattus) [TaxId:10117] [47501] (4 PDB entries)
    Uniprot P02625
  8. 768674Domain d1rwya_: 1rwy A: [98002]

Details for d1rwya_

PDB Entry: 1rwy (more details), 1.05 Å

PDB Description: crystal structure of rat alpha-parvalbumin at 1.05 resolution
PDB Compounds: (A:) parvalbumin alpha

SCOP Domain Sequences for d1rwya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]}
smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
delgsilkgfssdardlsaketktlmaagdkdgdgkigveefstlvaes

SCOP Domain Coordinates for d1rwya_:

Click to download the PDB-style file with coordinates for d1rwya_.
(The format of our PDB-style files is described here.)

Timeline for d1rwya_: