Lineage for d1rwth_ (1rwt H:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426993Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 426994Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (1 family) (S)
    duplication: contains two structural repeats
  5. 426995Family f.43.1.1: Chlorophyll a-b binding protein [103512] (1 protein)
  6. 426996Protein Chlorophyll a-b binding protein [103513] (1 species)
    part of chloroplast major light-harvesting complex; see also low-resolution structure of pea protein, PDB entry 1VCR
  7. 426997Species Spinach (Spinacia oleracea) [TaxId:3562] [103514] (1 PDB entry)
  8. 427005Domain d1rwth_: 1rwt H: [97999]

Details for d1rwth_

PDB Entry: 1rwt (more details), 2.72 Å

PDB Description: crystal structure of spinach major light-harvesting complex at 2.72 angstrom resolution

SCOP Domain Sequences for d1rwth_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwth_ f.43.1.1 (H:) Chlorophyll a-b binding protein {Spinach (Spinacia oleracea)}
spwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfaknrelevihcrwam
lgalgcvfpellarngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwacqvi
lmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkeikngrlamfsmfg
ffvqaivtgkgplenladhladpvnnnawnfatnfvpg

SCOP Domain Coordinates for d1rwth_:

Click to download the PDB-style file with coordinates for d1rwth_.
(The format of our PDB-style files is described here.)

Timeline for d1rwth_: