Lineage for d1rwtg_ (1rwt G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633630Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 2633631Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 2633632Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins)
  6. 2633633Protein Chlorophyll a-b binding protein [103513] (1 species)
    part of chloroplast major light-harvesting complex; see also low-resolution structure of pea protein, PDB entry 1VCR
  7. 2633634Species Spinach (Spinacia oleracea) [TaxId:3562] [103514] (1 PDB entry)
  8. 2633641Domain d1rwtg_: 1rwt G: [97998]
    complexed with bng, chl, cla, dgd, lhg, lut, na, nex, xat

Details for d1rwtg_

PDB Entry: 1rwt (more details), 2.72 Å

PDB Description: crystal structure of spinach major light-harvesting complex at 2.72 angstrom resolution
PDB Compounds: (G:) Chlorophyll A-B binding protein, chloroplast

SCOPe Domain Sequences for d1rwtg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwtg_ f.43.1.1 (G:) Chlorophyll a-b binding protein {Spinach (Spinacia oleracea) [TaxId: 3562]}
spwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfaknrelevihcrwam
lgalgcvfpellarngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwacqvi
lmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkeikngrlamfsmfg
ffvqaivtgkgplenladhladpvnnnawnfatnfvpg

SCOPe Domain Coordinates for d1rwtg_:

Click to download the PDB-style file with coordinates for d1rwtg_.
(The format of our PDB-style files is described here.)

Timeline for d1rwtg_: