Lineage for d1rwla1 (1rwl A:11-264)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065751Superfamily b.68.9: NHL repeat [101898] (1 family) (S)
  5. 2065752Family b.68.9.1: NHL repeat [101899] (2 protein domains)
    Pfam PF01436
  6. 2065757Protein Serine/threonine-protein kinase PknD [101902] (1 species)
  7. 2065758Species Mycobacterium tuberculosis [TaxId:1773] [101903] (2 PDB entries)
  8. 2065761Domain d1rwla1: 1rwl A:11-264 [97989]
    Other proteins in same PDB: d1rwla2
    complexed with cd

Details for d1rwla1

PDB Entry: 1rwl (more details), 1.9 Å

PDB Description: Extracellular domain of Mycobacterium tuberculosis PknD
PDB Compounds: (A:) Serine/threonine-protein kinase pknD

SCOPe Domain Sequences for d1rwla1:

Sequence, based on SEQRES records: (download)

>d1rwla1 b.68.9.1 (A:11-264) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}
gqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklatgstgttvlpfnglyqpq
glavdgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqgavyvadrgnnr
vvklaagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaesnnqvvlpftd
itapwgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplavavdsdrtvyva
drgndrvvkltsle

Sequence, based on observed residues (ATOM records): (download)

>d1rwla1 b.68.9.1 (A:11-264) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}
gqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklagttvlpfnglyqpqglav
dgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqgavyvadrgnnrvvkl
aagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaesnnqvvlpftditap
wgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplavavdsdrtvyvadrgn
drvvkltsle

SCOPe Domain Coordinates for d1rwla1:

Click to download the PDB-style file with coordinates for d1rwla1.
(The format of our PDB-style files is described here.)

Timeline for d1rwla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rwla2