Lineage for d1rwia1 (1rwi A:11-264)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808578Superfamily b.68.9: NHL repeat [101898] (2 families) (S)
  5. 2808579Family b.68.9.1: NHL repeat [101899] (2 proteins)
    Pfam PF01436
    this is a repeat family; one repeat unit is 1q7f B:871-914 found in domain
  6. 2808584Protein Serine/threonine-protein kinase PknD [101902] (1 species)
  7. 2808585Species Mycobacterium tuberculosis [TaxId:1773] [101903] (2 PDB entries)
  8. 2808586Domain d1rwia1: 1rwi A:11-264 [97987]
    Other proteins in same PDB: d1rwia2, d1rwib2
    complexed with cd

Details for d1rwia1

PDB Entry: 1rwi (more details), 1.8 Å

PDB Description: Extracellular domain of Mycobacterium tuberculosis PknD
PDB Compounds: (A:) Serine/threonine-protein kinase pknD

SCOPe Domain Sequences for d1rwia1:

Sequence, based on SEQRES records: (download)

>d1rwia1 b.68.9.1 (A:11-264) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}
gqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklatgstgttvlpfnglyqpq
glavdgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqgavyvadrgnnr
vvklaagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaesnnqvvlpftd
itapwgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplavavdsdrtvyva
drgndrvvkltsle

Sequence, based on observed residues (ATOM records): (download)

>d1rwia1 b.68.9.1 (A:11-264) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}
gqtvlpftgidfrlspsgvavdsagnvyvtsegmygrvvklagttvlpfnglyqpqglav
dgagtvyvtdfnnrvvtlaagsnnqtvlpfdglnypeglavdtqgavyvadrgnnrvvkl
aagsktqtvlpftglndpdgvavdnsgnvyvtdtdnnrvvkleaesnnqvvlpftditap
wgiavdeagtvyvtehntnqvvkllagsttstvlpftglntplavavdsdrtvyvadrgn
drvvkltsle

SCOPe Domain Coordinates for d1rwia1:

Click to download the PDB-style file with coordinates for d1rwia1.
(The format of our PDB-style files is described here.)

Timeline for d1rwia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rwia2