Lineage for d1rwha3 (1rwh A:373-644)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372072Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 372200Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 372204Protein Chondroitinase AC [50007] (2 species)
  7. 372205Species Arthrobacter aurescens [TaxId:43663] [101660] (6 PDB entries)
  8. 372206Domain d1rwha3: 1rwh A:373-644 [97986]
    Other proteins in same PDB: d1rwha1, d1rwha2
    complexed with gad, gct, gol, na, ngl, po4

Details for d1rwha3

PDB Entry: 1rwh (more details), 1.25 Å

PDB Description: crystal structure of arthrobacter aurescens chondroitin ac lyase in complex with chondroitin tetrasaccharide

SCOP Domain Sequences for d1rwha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwha3 b.30.5.2 (A:373-644) Chondroitinase AC {Arthrobacter aurescens}
atghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtgsgmtyfytsdlg
qyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatalgevaavgqhlvg
pgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsntlttaagtiagt
agtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvningsatvqqrnfatly
vnhgvgpvagsyaymvapgasvdltrkllegn

SCOP Domain Coordinates for d1rwha3:

Click to download the PDB-style file with coordinates for d1rwha3.
(The format of our PDB-style files is described here.)

Timeline for d1rwha3: