Lineage for d1rwha2 (1rwh A:645-757)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117795Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 1117796Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 1117797Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 1117801Protein Chondroitinase AC [49865] (2 species)
  7. 1117802Species Arthrobacter aurescens [TaxId:43663] [101619] (6 PDB entries)
  8. 1117803Domain d1rwha2: 1rwh A:645-757 [97985]
    Other proteins in same PDB: d1rwha1, d1rwha3
    complexed with gol, na, po4

Details for d1rwha2

PDB Entry: 1rwh (more details), 1.25 Å

PDB Description: crystal structure of arthrobacter aurescens chondroitin ac lyase in complex with chondroitin tetrasaccharide
PDB Compounds: (A:) chondroitin AC lyase

SCOPe Domain Sequences for d1rwha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwha2 b.24.1.1 (A:645-757) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]}
kysvirndataqsvefktakttaatfwkpgmagdlgasgpacvvfsrhgnelslavsept
qkaagltltlpegtwssvlegagtlgtdadgrstltldttglsgktkliklkr

SCOPe Domain Coordinates for d1rwha2:

Click to download the PDB-style file with coordinates for d1rwha2.
(The format of our PDB-style files is described here.)

Timeline for d1rwha2: