Lineage for d1rwga2 (1rwg A:645-757)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370953Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 370954Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 370955Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 370959Protein Chondroitinase AC [49865] (2 species)
  7. 370960Species Arthrobacter aurescens [TaxId:43663] [101619] (6 PDB entries)
  8. 370965Domain d1rwga2: 1rwg A:645-757 [97982]
    Other proteins in same PDB: d1rwga1, d1rwga3
    complexed with gad, gct, na, ngl, po4

Details for d1rwga2

PDB Entry: 1rwg (more details), 1.5 Å

PDB Description: crystal structure of arthrobacter aurescens chondroitin ac lyase in complex with chondroitin tetrasaccharide

SCOP Domain Sequences for d1rwga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwga2 b.24.1.1 (A:645-757) Chondroitinase AC {Arthrobacter aurescens}
kysvirndataqsvefktakttaatfwkpgmagdlgasgpacvvfsrhgnelslavsept
qkaagltltlpegtwssvlegagtlgtdadgrstltldttglsgktkliklkr

SCOP Domain Coordinates for d1rwga2:

Click to download the PDB-style file with coordinates for d1rwga2.
(The format of our PDB-style files is described here.)

Timeline for d1rwga2: