Lineage for d1rwga2 (1rwg A:645-757)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372607Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2372608Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (2 families) (S)
  5. 2372609Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 protein domains)
  6. 2372613Protein Chondroitinase AC [49865] (2 species)
  7. 2372614Species Arthrobacter aurescens [TaxId:43663] [101619] (6 PDB entries)
  8. 2372619Domain d1rwga2: 1rwg A:645-757 [97982]
    Other proteins in same PDB: d1rwga1, d1rwga3
    complexed with na, po4

Details for d1rwga2

PDB Entry: 1rwg (more details), 1.5 Å

PDB Description: crystal structure of arthrobacter aurescens chondroitin ac lyase in complex with chondroitin tetrasaccharide
PDB Compounds: (A:) chondroitin AC lyase

SCOPe Domain Sequences for d1rwga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwga2 b.24.1.1 (A:645-757) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]}
kysvirndataqsvefktakttaatfwkpgmagdlgasgpacvvfsrhgnelslavsept
qkaagltltlpegtwssvlegagtlgtdadgrstltldttglsgktkliklkr

SCOPe Domain Coordinates for d1rwga2:

Click to download the PDB-style file with coordinates for d1rwga2.
(The format of our PDB-style files is described here.)

Timeline for d1rwga2: