Lineage for d1rwga1 (1rwg A:4-372)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774353Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 774359Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 774363Protein Chondroitinase AC [48235] (2 species)
    Chondroitin AC lyase
  7. 774364Species Arthrobacter aurescens [TaxId:43663] [101368] (6 PDB entries)
  8. 774369Domain d1rwga1: 1rwg A:4-372 [97981]
    Other proteins in same PDB: d1rwga2, d1rwga3
    complexed with gad, gct, na, ngl, po4

Details for d1rwga1

PDB Entry: 1rwg (more details), 1.5 Å

PDB Description: crystal structure of arthrobacter aurescens chondroitin ac lyase in complex with chondroitin tetrasaccharide
PDB Compounds: (A:) chondroitin AC lyase

SCOP Domain Sequences for d1rwga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwga1 a.102.3.2 (A:4-372) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]}
pgaaefaalrnrwvdqitgrnviqagdpdfakaitalnnkaadslakldaaagrtsvftd
lslakdaemvttytrlsqlatawatptaavfgdaavlaaikagladantlcyndrkeevg
nwwsweigvpraladamvllhaelsaaertaycaaidhfvpdpwlqfppkrgkitsvgan
rvdlcqgiiirslagedptklnhavaglsqvwqyvtsgdgifrdgsfiqhsttpytgsyg
vvlltglsklfsllggtafevsdptrsiffdavegsfapvmingamadavrgrsisrean
tgydlgasaieailllaramdpataarwrglcagwiardtyrpilnsasvprtalvkqle
atgvapvae

SCOP Domain Coordinates for d1rwga1:

Click to download the PDB-style file with coordinates for d1rwga1.
(The format of our PDB-style files is described here.)

Timeline for d1rwga1: