![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins) |
![]() | Protein Chondroitinase AC [50007] (2 species) |
![]() | Species Arthrobacter aurescens [TaxId:43663] [101660] (6 PDB entries) |
![]() | Domain d1rwfa3: 1rwf A:373-644 [97980] Other proteins in same PDB: d1rwfa1, d1rwfa2 complexed with gad, gct, na, ngl, po4 |
PDB Entry: 1rwf (more details), 1.45 Å
SCOP Domain Sequences for d1rwfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwfa3 b.30.5.2 (A:373-644) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]} atghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtgsgmtyfytsdlg qyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatalgevaavgqhlvg pgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsntlttaagtiagt agtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvningsatvqqrnfatly vnhgvgpvagsyaymvapgasvdltrkllegn
Timeline for d1rwfa3: