Lineage for d1rwca3 (1rwc A:373-644)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372072Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 372200Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 372204Protein Chondroitinase AC [50007] (2 species)
  7. 372205Species Arthrobacter aurescens [TaxId:43663] [101660] (6 PDB entries)
  8. 372211Domain d1rwca3: 1rwc A:373-644 [97976]
    Other proteins in same PDB: d1rwca1, d1rwca2
    complexed with gad, gol, na, nag, po4

Details for d1rwca3

PDB Entry: 1rwc (more details), 1.9 Å

PDB Description: Crystal structure of Arthrobacter aurescens chondroitin AC lyase

SCOP Domain Sequences for d1rwca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwca3 b.30.5.2 (A:373-644) Chondroitinase AC {Arthrobacter aurescens}
atghklfpamdrtmhrgpgwalslalssnriawyecgngennrgyhtgsgmtyfytsdlg
qyddafwatanynrlpgitvdttplpdkvegqwgaavpadewsgatalgevaavgqhlvg
pgrtgltarkswfvsgdvtvclgadistasgakvetivdhrnlhqgsntlttaagtiagt
agtvevlgdgrwvhlegfggyamlddsplhvlretrsgswsgvningsatvqqrnfatly
vnhgvgpvagsyaymvapgasvdltrkllegn

SCOP Domain Coordinates for d1rwca3:

Click to download the PDB-style file with coordinates for d1rwca3.
(The format of our PDB-style files is described here.)

Timeline for d1rwca3: