Lineage for d1rwca2 (1rwc A:645-757)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 793854Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 793855Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 793856Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (4 proteins)
  6. 793860Protein Chondroitinase AC [49865] (2 species)
  7. 793861Species Arthrobacter aurescens [TaxId:43663] [101619] (6 PDB entries)
  8. 793867Domain d1rwca2: 1rwc A:645-757 [97975]
    Other proteins in same PDB: d1rwca1, d1rwca3
    complexed with gad, gol, na, nag, po4

Details for d1rwca2

PDB Entry: 1rwc (more details), 1.9 Å

PDB Description: crystal structure of arthrobacter aurescens chondroitin ac lyase
PDB Compounds: (A:) chondroitin AC lyase

SCOP Domain Sequences for d1rwca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rwca2 b.24.1.1 (A:645-757) Chondroitinase AC {Arthrobacter aurescens [TaxId: 43663]}
kysvirndataqsvefktakttaatfwkpgmagdlgasgpacvvfsrhgnelslavsept
qkaagltltlpegtwssvlegagtlgtdadgrstltldttglsgktkliklkr

SCOP Domain Coordinates for d1rwca2:

Click to download the PDB-style file with coordinates for d1rwca2.
(The format of our PDB-style files is described here.)

Timeline for d1rwca2: