Lineage for d1rw2a_ (1rw2 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 359729Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 360201Superfamily a.118.19: C-terminal domain of Ku80 [101420] (1 family) (S)
  5. 360202Family a.118.19.1: C-terminal domain of Ku80 [101421] (1 protein)
  6. 360203Protein C-terminal domain of Ku80 [101422] (1 species)
  7. 360204Species Human (Homo sapiens) [TaxId:9606] [101423] (2 PDB entries)
  8. 360206Domain d1rw2a_: 1rw2 A: [97961]

Details for d1rw2a_

PDB Entry: 1rw2 (more details)

PDB Description: Three-dimensional structure of Ku80 CTD

SCOP Domain Sequences for d1rw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw2a_ a.118.19.1 (A:) C-terminal domain of Ku80 {Human (Homo sapiens)}
mhhhhhhklkteqggahfsvsslaegsvtsvgsvnpaenfrvlvkqkkasfeeasnqlin
hieqfldtnetpyfmksidcirafreeaikfseeqrfnnflkalqekveikqlnhfweiv
vqdgitlitkeeasgssvtaeeakkflapkdk

SCOP Domain Coordinates for d1rw2a_:

Click to download the PDB-style file with coordinates for d1rw2a_.
(The format of our PDB-style files is described here.)

Timeline for d1rw2a_: