| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.19: C-terminal domain of Ku80 [101420] (1 family) ![]() automatically mapped to Pfam PF08785 |
| Family a.118.19.1: C-terminal domain of Ku80 [101421] (1 protein) |
| Protein C-terminal domain of Ku80 [101422] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [101423] (2 PDB entries) |
| Domain d1rw2a1: 1rw2 A:2-152 [97961] Other proteins in same PDB: d1rw2a2 |
PDB Entry: 1rw2 (more details)
SCOPe Domain Sequences for d1rw2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rw2a1 a.118.19.1 (A:2-152) C-terminal domain of Ku80 {Human (Homo sapiens) [TaxId: 9606]}
hhhhhhklkteqggahfsvsslaegsvtsvgsvnpaenfrvlvkqkkasfeeasnqlinh
ieqfldtnetpyfmksidcirafreeaikfseeqrfnnflkalqekveikqlnhfweivv
qdgitlitkeeasgssvtaeeakkflapkdk
Timeline for d1rw2a1: