Lineage for d1rw2a1 (1rw2 A:2-152)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.19: C-terminal domain of Ku80 [101420] (1 family) (S)
    automatically mapped to Pfam PF08785
  5. Family a.118.19.1: C-terminal domain of Ku80 [101421] (1 protein)
  6. Protein C-terminal domain of Ku80 [101422] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101423] (2 PDB entries)
  8. Domain d1rw2a1: 1rw2 A:2-152 [97961]
    Other proteins in same PDB: d1rw2a2

Details for d1rw2a1

PDB Entry: 1rw2 (more details)

PDB Description: Three-dimensional structure of Ku80 CTD
PDB Compounds: (A:) ATP-dependent DNA helicase II, 80 kDa subunit

SCOPe Domain Sequences for d1rw2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw2a1 a.118.19.1 (A:2-152) C-terminal domain of Ku80 {Human (Homo sapiens) [TaxId: 9606]}
hhhhhhklkteqggahfsvsslaegsvtsvgsvnpaenfrvlvkqkkasfeeasnqlinh
ieqfldtnetpyfmksidcirafreeaikfseeqrfnnflkalqekveikqlnhfweivv
qdgitlitkeeasgssvtaeeakkflapkdk

SCOPe Domain Coordinates for d1rw2a1 are not available.

Timeline for d1rw2a1:

Domains from same chain:
(mouse over for more information)
d1rw2a2