Lineage for d1rvzl_ (1rvz L:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467317Domain d1rvzl_: 1rvz L: [97960]
    Other proteins in same PDB: d1rvza_, d1rvzc_, d1rvze_, d1rvzg_, d1rvzi_, d1rvzk_
    1934 human H1
    complexed with nag

Details for d1rvzl_

PDB Entry: 1rvz (more details), 2.25 Å

PDB Description: 1934 h1 hemagglutinin in complex with lstc
PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d1rvzl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvzl_ h.3.1.1 (L:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOPe Domain Coordinates for d1rvzl_:

Click to download the PDB-style file with coordinates for d1rvzl_.
(The format of our PDB-style files is described here.)

Timeline for d1rvzl_: