Lineage for d1rvzf_ (1rvz F:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969580Protein Influenza hemagglutinin (stalk) [58066] (8 species)
    trimer
  7. 1969596Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)
  8. 1969623Domain d1rvzf_: 1rvz F: [97954]
    Other proteins in same PDB: d1rvza_, d1rvzc_, d1rvze_, d1rvzg_, d1rvzi_, d1rvzk_
    1934 human H1
    complexed with nag

Details for d1rvzf_

PDB Entry: 1rvz (more details), 2.25 Å

PDB Description: 1934 h1 hemagglutinin in complex with lstc
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d1rvzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvzf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOPe Domain Coordinates for d1rvzf_:

Click to download the PDB-style file with coordinates for d1rvzf_.
(The format of our PDB-style files is described here.)

Timeline for d1rvzf_: