Lineage for d1rvze_ (1rvz E:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370579Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 370580Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 370625Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 370626Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 370627Species Influenza A virus, different strains [TaxId:11320] [49825] (36 PDB entries)
  8. 370676Domain d1rvze_: 1rvz E: [97953]
    Other proteins in same PDB: d1rvzb_, d1rvzd_, d1rvzf_, d1rvzh_, d1rvzj_, d1rvzl_

Details for d1rvze_

PDB Entry: 1rvz (more details), 2.25 Å

PDB Description: 1934 h1 hemagglutinin in complex with lstc

SCOP Domain Sequences for d1rvze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvze_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
llgnpecdpllpvrswsyivetpnsengicypgdfidyeelreqlssvssferfeifpke
sswpnhntngvtaacshegkssfyrnllwltekegsypklknsyvnkkgkevlvlwgihh
ppnskeqqnlyqnenayvsvvtsnynrrftpeiaerpkvrdqagrmnyywtllkpgdtii
feangnliapmyafalrrgfgsgiitsnasmhecntkcqtplgainsslpyqnihpvtig
ecpkyvrsaklrmvtglrnipar

SCOP Domain Coordinates for d1rvze_:

Click to download the PDB-style file with coordinates for d1rvze_.
(The format of our PDB-style files is described here.)

Timeline for d1rvze_: