Lineage for d1rvxj_ (1rvx J:)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 895846Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 895847Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 895848Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 895849Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 895850Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 895865Domain d1rvxj_: 1rvx J: [97946]
    Other proteins in same PDB: d1rvxa_, d1rvxc_, d1rvxe_, d1rvxg_, d1rvxi_, d1rvxk_
    1934 human H1

Details for d1rvxj_

PDB Entry: 1rvx (more details), 2.2 Å

PDB Description: 1934 h1 hemagglutinin in complex with lsta
PDB Compounds: (J:) Hemagglutinin

SCOP Domain Sequences for d1rvxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvxj_ h.3.1.1 (J:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOP Domain Coordinates for d1rvxj_:

Click to download the PDB-style file with coordinates for d1rvxj_.
(The format of our PDB-style files is described here.)

Timeline for d1rvxj_: