Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
Domain d1rvxh_: 1rvx H: [97944] Other proteins in same PDB: d1rvxa_, d1rvxc_, d1rvxe_, d1rvxg_, d1rvxi_, d1rvxk_ 1934 human H1 complexed with nag |
PDB Entry: 1rvx (more details), 2.2 Å
SCOPe Domain Sequences for d1rvxh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rvxh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye kvksqlknnakeigngcfefyhkcdnecmesvrngtydyp
Timeline for d1rvxh_: