Lineage for d1rvxf_ (1rvx F:)

  1. Root: SCOPe 2.02
  2. 1246834Class h: Coiled coil proteins [57942] (7 folds)
  3. 1247941Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1247942Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1247943Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1247944Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1247945Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 1247958Domain d1rvxf_: 1rvx F: [97942]
    Other proteins in same PDB: d1rvxa_, d1rvxc_, d1rvxe_, d1rvxg_, d1rvxi_, d1rvxk_
    1934 human H1
    complexed with nag

Details for d1rvxf_

PDB Entry: 1rvx (more details), 2.2 Å

PDB Description: 1934 h1 hemagglutinin in complex with lsta
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d1rvxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvxf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
iqftavgkefnklekrmenlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcdnecmesvrngtydy

SCOPe Domain Coordinates for d1rvxf_:

Click to download the PDB-style file with coordinates for d1rvxf_.
(The format of our PDB-style files is described here.)

Timeline for d1rvxf_: