SCOPe 2.06: Domain d1rvtl_: 1rvt L:

Lineage for d1rvtl_ (1rvt L:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (9 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)

8. Domain d1rvtl_: 1rvt L: [97935]
   Other proteins in same PDB: d1rvti_, d1rvtk_, d1rvtm_
   1930 swine H1
   complexed with gal, ndg, sia

Details for d1rvtl_

PDB Entry: 1rvt, 2.5 Å

PDB Description: 1930 h1 hemagglutinin in complex with lstc

PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d1rvtl_:

Sequence; same for both SEQRES and ATOM records:

>d1rvtl_ b.19.1.2 (L:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledshngklcrlggiaplqlgkcniagw
llgnpecdllltvsswsyivetsnsdngtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettrgvtaacpyagassfyrnllwlvkkgnsypklsksyvnnkgkevlvlwgvh
hpptstdqqslyqnadayvsvgsskydrrftpeiaarpkvrgqagrmnyywtllepgdti
tfeatgnlvapryafalnrgsgsgiitsdapvhdcdtkcqtphgainsslpfqnihpvti
gecpkyvkstklrmatglrnipar

Timeline for d1rvtl_:

• d1rvtl_ first appeared in SCOP 1.67
  
• d1rvtl_ appears in SCOPe 2.05
  
• d1rvtl_ appears in SCOPe 2.07
  
• d1rvtl_ appears in the current release, SCOPe 2.08