Lineage for d1rvtk_ (1rvt K:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2591696Domain d1rvtk_: 1rvt K: [97934]
    Other proteins in same PDB: d1rvth_, d1rvtj_, d1rvtl_
    1930 swine H1
    complexed with gal, ndg, sia

Details for d1rvtk_

PDB Entry: 1rvt (more details), 2.5 Å

PDB Description: 1930 H1 Hemagglutinin in complex with LSTC
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d1rvtk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvtk_ h.3.1.1 (K:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
karsqlrnnakeigngcfefyhkcddacmesvrngtydyp

SCOPe Domain Coordinates for d1rvtk_:

Click to download the PDB-style file with coordinates for d1rvtk_.
(The format of our PDB-style files is described here.)

Timeline for d1rvtk_: