Lineage for d1rvjh1 (1rvj H:36-248)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2052959Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries)
    Uniprot P11846
  8. 2053025Domain d1rvjh1: 1rvj H:36-248 [97924]
    Other proteins in same PDB: d1rvjh2, d1rvjl_, d1rvjm_
    complexed with bcl, bph, cdl, fe2, lda, po4, spo, u10; mutant

Details for d1rvjh1

PDB Entry: 1rvj (more details), 2.75 Å

PDB Description: photosynthetic reaction center double mutant from rhodobacter sphaeroides with asp l213 replaced with asn and arg h177 replaced with his
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d1rvjh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvjh1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmahflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

SCOPe Domain Coordinates for d1rvjh1:

Click to download the PDB-style file with coordinates for d1rvjh1.
(The format of our PDB-style files is described here.)

Timeline for d1rvjh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rvjh2