Lineage for d1rvgd_ (1rvg D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444012Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. 2444013Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (3 species)
  7. 2444044Species Thermus aquaticus [TaxId:271] [102094] (2 PDB entries)
  8. 2444048Domain d1rvgd_: 1rvg D: [97923]
    complexed with co, na, so4, yt3

Details for d1rvgd_

PDB Entry: 1rvg (more details), 2 Å

PDB Description: crystal structure of class ii fructose-bisphosphate aldolase from thermus aquaticus in complex with y
PDB Compounds: (D:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1rvgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvgd_ c.1.10.2 (D:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]}
mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
svgra

SCOPe Domain Coordinates for d1rvgd_:

Click to download the PDB-style file with coordinates for d1rvgd_.
(The format of our PDB-style files is described here.)

Timeline for d1rvgd_: