Lineage for d1rvgc_ (1rvg C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 972775Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins)
    metal-dependent
  6. 972776Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (2 species)
  7. 972784Species Thermus aquaticus [TaxId:271] [102094] (2 PDB entries)
  8. 972787Domain d1rvgc_: 1rvg C: [97922]
    complexed with co, na, so4, yt3

Details for d1rvgc_

PDB Entry: 1rvg (more details), 2 Å

PDB Description: crystal structure of class ii fructose-bisphosphate aldolase from thermus aquaticus in complex with y
PDB Compounds: (C:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1rvgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rvgc_ c.1.10.2 (C:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]}
mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
svgra

SCOPe Domain Coordinates for d1rvgc_:

Click to download the PDB-style file with coordinates for d1rvgc_.
(The format of our PDB-style files is described here.)

Timeline for d1rvgc_: