Lineage for d1rv8b_ (1rv8 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1822456Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. 1822457Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (2 species)
  7. 1822465Species Thermus aquaticus [TaxId:271] [102094] (2 PDB entries)
  8. 1822471Domain d1rv8b_: 1rv8 B: [97917]
    complexed with co, na, so4

Details for d1rv8b_

PDB Entry: 1rv8 (more details), 2.3 Å

PDB Description: Class II fructose-1,6-bisphosphate aldolase from Thermus aquaticus in complex with cobalt
PDB Compounds: (B:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1rv8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv8b_ c.1.10.2 (B:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]}
mlvtgleilkkareegygvgafnvnnmeflqavleaaeeqrspvilalsegamkyggral
tlmavelakearvpvavhldhgssyesvlralragftsvmidkshedfetnvretrrvve
aahavgvtveaelgrlagieehvavdekdalltnpeearifmertgadylavaigtshga
ykgkgrpfidharleriarlvpaplvlhgasavppelverfrasggeigeaagihpedik
kaislgiakintdtdlrlaftalirealnknpkefdprkylgpareavkevvksrmelfg
svgra

SCOPe Domain Coordinates for d1rv8b_:

Click to download the PDB-style file with coordinates for d1rv8b_.
(The format of our PDB-style files is described here.)

Timeline for d1rv8b_: