SCOP 1.71: Domain d1rv6y_: 1rv6 Y:

Lineage for d1rv6y_ (1rv6 Y:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein Second domain of the Flt-1 receptor [49188] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)

8. Domain d1rv6y_: 1rv6 Y: [97915]
   Other proteins in same PDB: d1rv6v_, d1rv6w_
   complexed with b3p

Details for d1rv6y_

PDB Entry: 1rv6, 2.45 Å

PDB Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1

SCOP Domain Sequences for d1rv6y_:

Sequence; same for both SEQRES and ATOM records:

>d1rv6y_ b.1.1.4 (Y:) Second domain of the Flt-1 receptor {Human (Homo sapiens)}
rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
iisnatykeiglltceatvnghlyktnylthr

Timeline for d1rv6y_:

• d1rv6y_ first appeared in SCOP 1.67
  
• d1rv6y_ appears in SCOP 1.69
  
• d1rv6y_ appears in SCOP 1.73
  
• d1rv6y_ appears in the current release, SCOPe 2.08