SCOPe 2.01: Domain d1rv6x_: 1rv6 X:

Lineage for d1rv6x_ (1rv6 X:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Second domain of the Flt-1 receptor [49188] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)

8. Domain d1rv6x_: 1rv6 X: [97914]
   Other proteins in same PDB: d1rv6v_, d1rv6w_
   complexed with b3p

Details for d1rv6x_

PDB Entry: 1rv6, 2.45 Å

PDB Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1

PDB Compounds: (X:) FLT1 protein

SCOPe Domain Sequences for d1rv6x_:

Sequence; same for both SEQRES and ATOM records:

>d1rv6x_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
iisnatykeiglltceatvnghlyktnylthr

Timeline for d1rv6x_:

• d1rv6x_ first appeared in SCOP 1.67
  
• d1rv6x_ appears in SCOP 1.75
  
• d1rv6x_ appears in SCOPe 2.02
  
• d1rv6x_ appears in the current release, SCOPe 2.08