Lineage for d1rv6x_ (1rv6 X:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 787055Family b.1.1.4: I set domains [49159] (38 proteins)
  6. 787368Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 787369Species Human (Homo sapiens) [TaxId:9606] [49189] (5 PDB entries)
  8. 787372Domain d1rv6x_: 1rv6 X: [97914]
    Other proteins in same PDB: d1rv6v_, d1rv6w_

Details for d1rv6x_

PDB Entry: 1rv6 (more details), 2.45 Å

PDB Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1
PDB Compounds: (X:) FLT1 protein

SCOP Domain Sequences for d1rv6x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv6x_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
iisnatykeiglltceatvnghlyktnylthr

SCOP Domain Coordinates for d1rv6x_:

Click to download the PDB-style file with coordinates for d1rv6x_.
(The format of our PDB-style files is described here.)

Timeline for d1rv6x_: