Class g: Small proteins [56992] (90 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein Placenta growth factor-1, PLGF-1 [64560] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64561] (2 PDB entries) |
Domain d1rv6w_: 1rv6 W: [97913] Other proteins in same PDB: d1rv6x_, d1rv6y_ complexed with b3p |
PDB Entry: 1rv6 (more details), 2.45 Å
SCOPe Domain Sequences for d1rv6w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rv6w_ g.17.1.1 (W:) Placenta growth factor-1, PLGF-1 {Human (Homo sapiens) [TaxId: 9606]} evvpfqevwgrsycralerlvdvvseypsevehmfspscvsllrctgccgdenlhcvpve tanvtmqllkirsgdrpsyveltfsqhvrcecrpl
Timeline for d1rv6w_: