Lineage for d1rv2d1 (1rv2 D:1-375)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397315Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 397627Superfamily c.55.3: Ribonuclease H-like [53098] (9 families) (S)
    consists of one domain of this fold
  5. 397834Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins)
  6. 397835Protein Exonuclease domain of family B DNA polymerases [53125] (7 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 397845Species Bacteriophage RB69 [TaxId:12353] [53127] (8 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 397854Domain d1rv2d1: 1rv2 D:1-375 [97910]
    Other proteins in same PDB: d1rv2a2, d1rv2b2, d1rv2c2, d1rv2d2
    complexed with 3dr; mutant

Details for d1rv2d1

PDB Entry: 1rv2 (more details), 2.8 Å

PDB Description: Crystal structure of RB69 gp43 in complex with DNA containing an abasic site analog

SCOP Domain Sequences for d1rv2d1:

Sequence, based on SEQRES records: (download)

>d1rv2d1 c.55.3.5 (D:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

Sequence, based on observed residues (ATOM records): (download)

>d1rv2d1 c.55.3.5 (D:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkveiitlfgisvldyidlykkfsftnqpsysldyisefelnvgklkydgp
isklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfspiktwdai
ifnslke

SCOP Domain Coordinates for d1rv2d1:

Click to download the PDB-style file with coordinates for d1rv2d1.
(The format of our PDB-style files is described here.)

Timeline for d1rv2d1: