Lineage for d1rv2a1 (1rv2 A:1-375)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586646Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) (S)
    consists of one domain of this fold
  5. 586884Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (10 proteins)
    contains Pfam 00929
  6. 586885Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 586895Species Bacteriophage RB69 [TaxId:12353] [53127] (8 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 586905Domain d1rv2a1: 1rv2 A:1-375 [97904]
    Other proteins in same PDB: d1rv2a2, d1rv2b2, d1rv2c2, d1rv2d2

Details for d1rv2a1

PDB Entry: 1rv2 (more details), 2.8 Å

PDB Description: Crystal structure of RB69 gp43 in complex with DNA containing an abasic site analog

SCOP Domain Sequences for d1rv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv2a1 c.55.3.5 (A:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOP Domain Coordinates for d1rv2a1:

Click to download the PDB-style file with coordinates for d1rv2a1.
(The format of our PDB-style files is described here.)

Timeline for d1rv2a1: