Lineage for d1rv1c_ (1rv1 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712499Domain d1rv1c_: 1rv1 C: [97903]
    complexed with imz

Details for d1rv1c_

PDB Entry: 1rv1 (more details), 2.3 Å

PDB Description: crystal structure of human mdm2 with an imidazoline inhibitor
PDB Compounds: (C:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1rv1c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv1c_ a.42.1.1 (C:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOPe Domain Coordinates for d1rv1c_:

Click to download the PDB-style file with coordinates for d1rv1c_.
(The format of our PDB-style files is described here.)

Timeline for d1rv1c_: