| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) ![]() binds to the transactivation domain of human p53 |
| Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins) Pfam 02201 |
| Protein MDM2 [47594] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47596] (2 PDB entries) |
| Domain d1rv1b_: 1rv1 B: [97902] |
PDB Entry: 1rv1 (more details), 2.3 Å
SCOP Domain Sequences for d1rv1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rv1b_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens)}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv
Timeline for d1rv1b_: