Lineage for d1rv1b_ (1rv1 B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355856Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 355857Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) (S)
    binds to the transactivation domain of human p53
  5. 355858Family a.42.1.1: SWIB/MDM2 domain [47593] (3 proteins)
    Pfam 02201
  6. 355865Protein MDM2 [47594] (2 species)
  7. 355868Species Human (Homo sapiens) [TaxId:9606] [47596] (2 PDB entries)
  8. 355870Domain d1rv1b_: 1rv1 B: [97902]

Details for d1rv1b_

PDB Entry: 1rv1 (more details), 2.3 Å

PDB Description: crystal structure of human mdm2 with an imidazoline inhibitor

SCOP Domain Sequences for d1rv1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv1b_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens)}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOP Domain Coordinates for d1rv1b_:

Click to download the PDB-style file with coordinates for d1rv1b_.
(The format of our PDB-style files is described here.)

Timeline for d1rv1b_: