SCOPe 2.01: Domain d1rv1a_: 1rv1 A:

Lineage for d1rv1a_ (1rv1 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (14 PDB entries)

8. Domain d1rv1a_: 1rv1 A: [97901]
   complexed with imz

Details for d1rv1a_

PDB Entry: 1rv1, 2.3 Å

PDB Description: crystal structure of human mdm2 with an imidazoline inhibitor

PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d1rv1a_:

Sequence; same for both SEQRES and ATOM records:

>d1rv1a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

Timeline for d1rv1a_:

• d1rv1a_ first appeared in SCOP 1.67
  
• d1rv1a_ appears in SCOP 1.75
  
• d1rv1a_ appears in SCOPe 2.02
  
• d1rv1a_ appears in the current release, SCOPe 2.08