Lineage for d1rv0k_ (1rv0 K:)

  1. Root: SCOPe 2.03
  2. 1466120Class h: Coiled coil proteins [57942] (7 folds)
  3. 1467291Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1467292Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 1467293Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 1467294Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 1467295Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries)
  8. 1467333Domain d1rv0k_: 1rv0 K: [97898]
    Other proteins in same PDB: d1rv0h_, d1rv0j_, d1rv0l_
    1930 swine H1
    complexed with dan, ndg

Details for d1rv0k_

PDB Entry: 1rv0 (more details), 2.5 Å

PDB Description: 1930 Swine H1 Hemagglutinin complexed with LSTA
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d1rv0k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv0k_ h.3.1.1 (K:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
karsqlrnnakeigngcfefyhkcddacmesvrngtydyp

SCOPe Domain Coordinates for d1rv0k_:

Click to download the PDB-style file with coordinates for d1rv0k_.
(The format of our PDB-style files is described here.)

Timeline for d1rv0k_: