![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (2 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (45 PDB entries) |
![]() | Domain d1rv0k_: 1rv0 K: [97898] Other proteins in same PDB: d1rv0h_, d1rv0j_, d1rv0l_ 1930 swine H1 complexed with dan, ndg |
PDB Entry: 1rv0 (more details), 2.5 Å
SCOPe Domain Sequences for d1rv0k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rv0k_ h.3.1.1 (K:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye karsqlrnnakeigngcfefyhkcddacmesvrngtydyp
Timeline for d1rv0k_: