Lineage for d1rv0i_ (1rv0 I:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645407Protein Influenza hemagglutinin (stalk) [58066] (17 species)
    trimer
  7. 2645520Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries)
  8. 2645570Domain d1rv0i_: 1rv0 I: [97896]
    Other proteins in same PDB: d1rv0h_, d1rv0j_, d1rv0l_
    1930 swine H1
    complexed with dan, ndg

Details for d1rv0i_

PDB Entry: 1rv0 (more details), 2.5 Å

PDB Description: 1930 swine h1 hemagglutinin complexed with lsta
PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d1rv0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv0i_ h.3.1.1 (I:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerriknlnkkvddgfldvwtynaellvllenertldfhdsnvknlye
karsqlrnnakeigngcfefyhkcddacmesvrngtydyp

SCOPe Domain Coordinates for d1rv0i_:

Click to download the PDB-style file with coordinates for d1rv0i_.
(The format of our PDB-style files is described here.)

Timeline for d1rv0i_: