Lineage for d1ruzm_ (1ruz M:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525919Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 525920Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 525921Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 525922Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 525923Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 526011Domain d1ruzm_: 1ruz M: [97894]
    Other proteins in same PDB: d1ruzh_, d1ruzj_, d1ruzl_
    1918 human H1

Details for d1ruzm_

PDB Entry: 1ruz (more details), 2.9 Å

PDB Description: 1918 h1 hemagglutinin

SCOP Domain Sequences for d1ruzm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruzm_ h.3.1.1 (M:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydyp

SCOP Domain Coordinates for d1ruzm_:

Click to download the PDB-style file with coordinates for d1ruzm_.
(The format of our PDB-style files is described here.)

Timeline for d1ruzm_: