Lineage for d1ruzj_ (1ruz J:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040609Domain d1ruzj_: 1ruz J: [97891]
    Other proteins in same PDB: d1ruzi_, d1ruzk_, d1ruzm_
    1918 human H1
    complexed with nag, ndg

Details for d1ruzj_

PDB Entry: 1ruz (more details), 2.9 Å

PDB Description: 1918 H1 Hemagglutinin
PDB Compounds: (J:) Hemagglutinin

SCOPe Domain Sequences for d1ruzj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruzj_ b.19.1.2 (J:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrdqagrmnyywtllepgdti
tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
gecpkyvrstklrmatglrnipar

SCOPe Domain Coordinates for d1ruzj_:

Click to download the PDB-style file with coordinates for d1ruzj_.
(The format of our PDB-style files is described here.)

Timeline for d1ruzj_: