Lineage for d1ruym_ (1ruy M:)

  1. Root: SCOP 1.67
  2. 431023Class h: Coiled coil proteins [57942] (6 folds)
  3. 431801Fold h.3: Stalk segment of viral fusion proteins [58063] (2 superfamilies)
    core: trimeric coiled coil
  4. 431802Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 431803Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 431804Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 431805Species Influenza A virus, different strains [TaxId:11320] [58067] (35 PDB entries)
  8. 431854Domain d1ruym_: 1ruy M: [97888]
    Other proteins in same PDB: d1ruyh_, d1ruyj_, d1ruyl_
    1930 swine H1
    complexed with nag

Details for d1ruym_

PDB Entry: 1ruy (more details), 2.7 Å

PDB Description: 1930 Swine H1 Hemagglutinin

SCOP Domain Sequences for d1ruym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruym_ h.3.1.1 (M:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnklekrienlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvrsqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOP Domain Coordinates for d1ruym_:

Click to download the PDB-style file with coordinates for d1ruym_.
(The format of our PDB-style files is described here.)

Timeline for d1ruym_: