Lineage for d1ruym_ (1ruy M:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041215Domain d1ruym_: 1ruy M: [97888]
    Other proteins in same PDB: d1ruyh_, d1ruyj_, d1ruyl_
    1930 swine H1
    complexed with nag, ndg

Details for d1ruym_

PDB Entry: 1ruy (more details), 2.7 Å

PDB Description: 1930 swine h1 hemagglutinin
PDB Compounds: (M:) Hemagglutinin

SCOPe Domain Sequences for d1ruym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruym_ h.3.1.1 (M:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnklekrienlnnkvddgfldiwtynaellvllenertldfhdsnvknlye
kvrsqlknnakeigngcfefyhkcdnecmesvrngtydyp

SCOPe Domain Coordinates for d1ruym_:

Click to download the PDB-style file with coordinates for d1ruym_.
(The format of our PDB-style files is described here.)

Timeline for d1ruym_: