Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
Domain d1ruym_: 1ruy M: [97888] Other proteins in same PDB: d1ruyh_, d1ruyj_, d1ruyl_ 1930 swine H1 complexed with nag, ndg |
PDB Entry: 1ruy (more details), 2.7 Å
SCOPe Domain Sequences for d1ruym_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ruym_ h.3.1.1 (M:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwtglidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn tqftavgkefnklekrienlnnkvddgfldiwtynaellvllenertldfhdsnvknlye kvrsqlknnakeigngcfefyhkcdnecmesvrngtydyp
Timeline for d1ruym_: