Lineage for d1rurl1 (1rur L:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363551Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)
  8. 363559Domain d1rurl1: 1rur L:1-107 [97881]
    Other proteins in same PDB: d1rurh1, d1rurh2, d1rurl2
    part of Diels-Alder catalytic Fab 13G5
    complexed with zn

Details for d1rurl1

PDB Entry: 1rur (more details), 1.5 Å

PDB Description: crystal structure (i) of native diels-alder antibody 13g5 fab at ph 8.0 with a data set collected at ssrl beamline 9-1.
PDB Compounds: (L:)

SCOP Domain Sequences for d1rurl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rurl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divltqaafsnpvtlgasasiscrssksllnsngiihmywylqkpgqspqlliyqmskla
sgapdrfsgsgsgtdftlrisrveaedvgvyycaqnlelpytfgggtkleik

SCOP Domain Coordinates for d1rurl1:

Click to download the PDB-style file with coordinates for d1rurl1.
(The format of our PDB-style files is described here.)

Timeline for d1rurl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rurl2