Lineage for d1ruql2 (1ruq L:108-212)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454082Domain d1ruql2: 1ruq L:108-212 [97878]
    Other proteins in same PDB: d1ruqh1, d1ruqh2, d1ruql1
    part of Diels-Alder catalytic Fab 13G5

Details for d1ruql2

PDB Entry: 1ruq (more details), 1.86 Å

PDB Description: Crystal Structure (H) of u.v.-irradiated Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set collected in house.

SCOP Domain Sequences for d1ruql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ruql2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
tkdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1ruql2:

Click to download the PDB-style file with coordinates for d1ruql2.
(The format of our PDB-style files is described here.)

Timeline for d1ruql2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ruql1