Lineage for d1rumh2 (1rum H:114-231)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453402Domain d1rumh2: 1rum H:114-231 [97868]
    Other proteins in same PDB: d1rumh1, d1ruml1, d1ruml2
    part of cationic cyclization catalytic Fab 4C6

Details for d1rumh2

PDB Entry: 1rum (more details), 1.48 Å

PDB Description: crystal structure (f) of h2o2-soaked cationic cyclization antibody 4c6 fab at ph 8.5 with a data set collected at ssrl beamline 9-1.

SCOP Domain Sequences for d1rumh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rumh2 b.1.1.2 (H:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

SCOP Domain Coordinates for d1rumh2:

Click to download the PDB-style file with coordinates for d1rumh2.
(The format of our PDB-style files is described here.)

Timeline for d1rumh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rumh1